Lineage for d1vf8a1 (1vf8 A:1-245,A:316-372)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683248Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 683355Protein Chitinase-like lectin ym1, saccharide binding domain [63910] (1 species)
  7. 683356Species Mouse (Mus musculus) [TaxId:10090] [63911] (2 PDB entries)
  8. 683357Domain d1vf8a1: 1vf8 A:1-245,A:316-372 [120029]
    Other proteins in same PDB: d1vf8a2
    automatically matched to d1e9la1

Details for d1vf8a1

PDB Entry: 1vf8 (more details), 1.31 Å

PDB Description: The Crystal Structure of Ym1 at 1.31 A Resolution
PDB Compounds: (A:) secretory protein

SCOP Domain Sequences for d1vf8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]}
yqlmcyytswakdrpiegsfkpgnidpclcthliyafagmqnneitytheqdlrdyealn
glkdkntelktllaiggwkfgpapfsamvstpqnrqifiqsvirflrqynfdglnldwqy
pgsrgsppkdkhlfsvlvkemrkafeeesvekdiprllltstgagiidviksgykipels
qsldyiqvmtydlhdpkdgytgensplykspydigksadlnvdsiisywkdhgaasekli
vgfpaXdnvrsfklkaqwlkdnnlggavvwpldmddfsgsfchqrhfpltstlkgdlnih
sas

SCOP Domain Coordinates for d1vf8a1:

Click to download the PDB-style file with coordinates for d1vf8a1.
(The format of our PDB-style files is described here.)

Timeline for d1vf8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vf8a2