![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
![]() | Protein beta-amylase [49462] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries) |
![]() | Domain d1vepa1: 1vep A:418-516 [120027] Other proteins in same PDB: d1vepa2 automatically matched to d1b90a1 complexed with ca, glc; mutant |
PDB Entry: 1vep (more details), 2.06 Å
SCOP Domain Sequences for d1vepa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vepa1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1vepa1: