![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.0: automated matches [254199] (1 protein) not a true family |
![]() | Protein automated matches [254436] (5 species) not a true protein |
![]() | Domain d1vepa1: 1vep A:418-516 [120027] Other proteins in same PDB: d1vepa2 automated match to d1vema1 complexed with ca |
PDB Entry: 1vep (more details), 2.06 Å
SCOPe Domain Sequences for d1vepa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vepa1 b.3.1.0 (A:418-516) automated matches {Bacillus cereus [TaxId: 1396]} tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1vepa1: