Lineage for d1vena2 (1ven A:1-417)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein automated matches [190099] (31 species)
not a true protein- Species Bacillus cereus [TaxId:1396] [254917] (3 PDB entries)
Domain d1vena2: 1ven A:1-417 [120024]
Other proteins in same PDB: d1vena1
automated match to d1vema2
complexed with ca, glc
Details for d1vena2
PDB Entry: 1ven (more details), 2.02 Å
PDB Description: crystal structure analysis of y164e/maltose of bacilus cereus beta- amylase at ph 4.6
PDB Compounds: (A:) beta-amylaseSCOPe Domain Sequences for d1vena2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vena2 c.1.8.1 (A:1-417) automated matches {Bacillus cereus [TaxId: 1396]}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakielsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv
SCOPe Domain Coordinates for d1vena2:
Click to download the PDB-style file with coordinates for d1vena2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vena2:
- d1vena2 first appeared in SCOP 1.73
- d1vena2 appears in SCOPe 2.07
View in 3D
