Lineage for d1vena1 (1ven A:418-516)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378394Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2378533Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2378534Protein automated matches [254436] (5 species)
    not a true protein
  7. Species Bacillus cereus [TaxId:1396] [254918] (3 PDB entries)
  8. 2378536Domain d1vena1: 1ven A:418-516 [120023]
    Other proteins in same PDB: d1vena2
    automated match to d1vema1
    complexed with ca, glc

Details for d1vena1

PDB Entry: 1ven (more details), 2.02 Å

PDB Description: crystal structure analysis of y164e/maltose of bacilus cereus beta- amylase at ph 4.6
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1vena1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vena1 b.3.1.0 (A:418-516) automated matches {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d1vena1:

Click to download the PDB-style file with coordinates for d1vena1.
(The format of our PDB-style files is described here.)

Timeline for d1vena1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vena2