| Class b: All beta proteins [48724] (165 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) ![]() |
| Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
| Protein beta-amylase [49462] (1 species) |
| Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries) |
| Domain d1vena1: 1ven A:418-516 [120023] Other proteins in same PDB: d1vena2 automatically matched to d1b90a1 complexed with ca, glc; mutant |
PDB Entry: 1ven (more details), 2.02 Å
SCOP Domain Sequences for d1vena1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vena1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1vena1: