Lineage for d1vema1 (1vem A:418-516)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 659819Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) (S)
  5. 659820Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 659821Protein beta-amylase [49462] (1 species)
  7. 659822Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries)
  8. 659823Domain d1vema1: 1vem A:418-516 [120021]
    Other proteins in same PDB: d1vema2
    automatically matched to d1b90a1
    complexed with ca, glc

Details for d1vema1

PDB Entry: 1vem (more details), 1.85 Å

PDB Description: crystal structure analysis of bacillus cereus beta-amylase at the optimum ph (6.5)
PDB Compounds: (A:) beta-amylase

SCOP Domain Sequences for d1vema1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOP Domain Coordinates for d1vema1:

Click to download the PDB-style file with coordinates for d1vema1.
(The format of our PDB-style files is described here.)

Timeline for d1vema1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vema2