Lineage for d1veja1 (1vej A:8-68)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984760Protein 4931431F19Rik [140343] (1 species)
    Riken cDNA clone 4931431f19
  7. 1984761Species Mouse (Mus musculus) [TaxId:10090] [140344] (1 PDB entry)
    Uniprot Q9D4I8 447-507
  8. 1984762Domain d1veja1: 1vej A:8-68 [120020]
    Other proteins in same PDB: d1veja2, d1veja3

Details for d1veja1

PDB Entry: 1vej (more details)

PDB Description: Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
PDB Compounds: (A:) RIKEN cDNA 4931431F19

SCOPe Domain Sequences for d1veja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]}
aracsqssqtalptslftegryqqeleelkalgfanrdanlqalvatdgdihaaiemllg
a

SCOPe Domain Coordinates for d1veja1:

Click to download the PDB-style file with coordinates for d1veja1.
(The format of our PDB-style files is described here.)

Timeline for d1veja1: