Lineage for d1vefb1 (1vef B:1009-1395)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840994Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 841063Protein Acetylornithine/acetyl-lysine aminotransferase ArgD [142674] (1 species)
  7. 841064Species Thermus thermophilus [TaxId:274] [142675] (3 PDB entries)
    Uniprot Q93R93 9-395
  8. 841066Domain d1vefb1: 1vef B:1009-1395 [120019]
    automatically matched to 1VEF A:9-395
    complexed with plp

Details for d1vefb1

PDB Entry: 1vef (more details), 1.35 Å

PDB Description: Acetylornithine aminotransferase from Thermus thermophilus HB8
PDB Compounds: (B:) Acetylornithine/acetyl-lysine aminotransferase

SCOP Domain Sequences for d1vefb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vefb1 c.67.1.4 (B:1009-1395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]}
wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
virflpplviekedlervveavravla

SCOP Domain Coordinates for d1vefb1:

Click to download the PDB-style file with coordinates for d1vefb1.
(The format of our PDB-style files is described here.)

Timeline for d1vefb1: