SCOP 1.73: Domain d1veba1: 1veb A:14-350

Lineage for d1veba1 (1veb A:14-350)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (31 PDB entries)

8. Domain d1veba1: 1veb A:14-350 [120017]
   automatically matched to d1q8ua_
   complexed with i05

Details for d1veba1

PDB Entry: 1veb, 2.89 Å

PDB Description: crystal structure of protein kinase a in complex with azepane derivative 5

PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d1veba1:

Sequence; same for both SEQRES and ATOM records:

>d1veba1 d.144.1.7 (A:14-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki
ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr
rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg
rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d1veba1:

• d1veba1 is new in SCOP 1.73
  
• d1veba1 appears in SCOP 1.75
  
• d1veba1 appears in the current release, SCOPe 2.08, called d1veba_