Lineage for d1ve5d_ (1ve5 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2140010Protein automated matches [190054] (13 species)
    not a true protein
  7. 2140070Species Thermus thermophilus HB8 [TaxId:300852] [187272] (5 PDB entries)
  8. 2140075Domain d1ve5d_: 1ve5 D: [120016]
    Other proteins in same PDB: d1ve5a1
    automated match to d1ve5a1
    complexed with ca, plp

Details for d1ve5d_

PDB Entry: 1ve5 (more details), 2.15 Å

PDB Description: Crystal Structure of T.th. HB8 Threonine deaminase
PDB Compounds: (D:) Threonine deaminase

SCOPe Domain Sequences for d1ve5d_:

Sequence, based on SEQRES records: (download)

>d1ve5d_ c.79.1.1 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
lenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvta
knreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvgggg
llaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslger
tfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlall
lsggnrdfsp

Sequence, based on observed residues (ATOM records): (download)

>d1ve5d_ c.79.1.1 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
lenpkgllavssgnhaqgvayaaqvlgvkalvvmpvaralqeetgyalihpfddplviag
qgtaglellaqagrmgvfpgavlapvggggllaglatavkalspttlvlgvepeaaddak
rsleagrilrleapprtradgvrtlslgertfpilrervdgiltvseealleaerllftr
tkqvveptgalplaavlehgarlpqtlalllsggnrdfsp

SCOPe Domain Coordinates for d1ve5d_:

Click to download the PDB-style file with coordinates for d1ve5d_.
(The format of our PDB-style files is described here.)

Timeline for d1ve5d_: