![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein automated matches [190054] (10 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187272] (5 PDB entries) |
![]() | Domain d1ve5c_: 1ve5 C: [120015] Other proteins in same PDB: d1ve5a1 automated match to d1ve5a1 complexed with ca, plp |
PDB Entry: 1ve5 (more details), 2.15 Å
SCOPe Domain Sequences for d1ve5c_:
Sequence, based on SEQRES records: (download)
>d1ve5c_ c.79.1.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala lenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvta knreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvgggg llaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslger tfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlall lsggnrdfsp
>d1ve5c_ c.79.1.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala lenpkgllavssgnhaqgvayaaqvlgvkalvalqeetgyalihpfddplviagqgtagl ellaqagrmgvfpgavlapvggggllaglatavkalspttlvlgvepeaaddakrsleag rilrleapprtradgvrtlslgertfpilrervdgiltvseealleaerllftrtkqvve ptgalplaavlehgarlpqtlalllsggnrdfsp
Timeline for d1ve5c_: