Lineage for d1ve5a1 (1ve5 A:2-311)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139908Protein Threonine deaminase [53692] (2 species)
  7. 2139911Species Thermus thermophilus [TaxId:274] [142747] (1 PDB entry)
    Uniprot Q5SLL4 2-311
  8. 2139912Domain d1ve5a1: 1ve5 A:2-311 [120013]
    Other proteins in same PDB: d1ve5b_, d1ve5c_, d1ve5d_
    complexed with ca, plp

Details for d1ve5a1

PDB Entry: 1ve5 (more details), 2.15 Å

PDB Description: Crystal Structure of T.th. HB8 Threonine deaminase
PDB Compounds: (A:) Threonine deaminase

SCOPe Domain Sequences for d1ve5a1:

Sequence, based on SEQRES records: (download)

>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]}
pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
lenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvta
knreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvgggg
llaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslger
tfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlall
lsggnrdfsp

Sequence, based on observed residues (ATOM records): (download)

>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]}
pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
lenpkgllavssgnhaqgvayaaqvlgvkalvvmpedpykkacaraygaevvdrgvtakn
reevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvggggll
aglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslgertf
pilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlallls
ggnrdfsp

SCOPe Domain Coordinates for d1ve5a1:

Click to download the PDB-style file with coordinates for d1ve5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ve5a1: