Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species) there is an additional C-terminal allosteric domain in some species |
Species Thermus thermophilus [TaxId:274] [142805] (1 PDB entry) Uniprot Q5SM15 1-206 |
Domain d1ve4a1: 1ve4 A:1-206 [120012] complexed with gol, so4 |
PDB Entry: 1ve4 (more details), 1.2 Å
SCOPe Domain Sequences for d1ve4a1:
Sequence, based on SEQRES records: (download)
>d1ve4a1 c.94.1.1 (A:1-206) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermus thermophilus [TaxId: 274]} mrrfaltvalpkgrmfreayevlkragldlpevegertllhgkeggvallelrnkdvpiy vdlgiaeigvvgkdvlldsgrdlfepvdlgfgacrlslirrpgdtgpirrvatkypnfta rllkergwaadvvelsgnielaavtgladavvdvvqtgatlraaglvevevlahstarlv vnrqalklkravlkpliqrlrelsgs
>d1ve4a1 c.94.1.1 (A:1-206) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermus thermophilus [TaxId: 274]} mrrfaltvalpkgrmfreayevlkragldlpevllhgkeggvallelrnkdvpiyvdlgi aeigvvgkdvlldsgrdlfepvdlgfgacrlslirrpgdtgpirrvatkypnftarllke rgwaadvvelsgnielaavtgladavvdvvqtgatlraaglvevevlahstarlvvnrqa lklkravlkpliqrlrelsgs
Timeline for d1ve4a1: