SCOPe 2.08: Domain d1ve4a1: 1ve4 A:1-206

Lineage for d1ve4a1 (1ve4 A:1-206)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
   there is an additional C-terminal allosteric domain in some species

7. Species Thermus thermophilus [TaxId:274] [142805] (1 PDB entry)
   Uniprot Q5SM15 1-206

8. Domain d1ve4a1: 1ve4 A:1-206 [120012]
   complexed with gol, so4

Details for d1ve4a1

PDB Entry: 1ve4, 1.2 Å

PDB Description: ATP-Phosphoribosyltransferase(hisG) from Thermus thermophilus HB8

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1ve4a1:

Sequence, based on SEQRES records:

>d1ve4a1 c.94.1.1 (A:1-206) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermus thermophilus [TaxId: 274]}
mrrfaltvalpkgrmfreayevlkragldlpevegertllhgkeggvallelrnkdvpiy
vdlgiaeigvvgkdvlldsgrdlfepvdlgfgacrlslirrpgdtgpirrvatkypnfta
rllkergwaadvvelsgnielaavtgladavvdvvqtgatlraaglvevevlahstarlv
vnrqalklkravlkpliqrlrelsgs

Sequence, based on observed residues (ATOM records):

>d1ve4a1 c.94.1.1 (A:1-206) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermus thermophilus [TaxId: 274]}
mrrfaltvalpkgrmfreayevlkragldlpevllhgkeggvallelrnkdvpiyvdlgi
aeigvvgkdvlldsgrdlfepvdlgfgacrlslirrpgdtgpirrvatkypnftarllke
rgwaadvvelsgnielaavtgladavvdvvqtgatlraaglvevevlahstarlvvnrqa
lklkravlkpliqrlrelsgs

Timeline for d1ve4a1:

• d1ve4a1 first appeared in SCOP 1.73
  
• d1ve4a1 appears in SCOPe 2.07