![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.43: CAC2371-like [117688] (3 proteins) similar overall fold to the Glycine N-methyltransferase (53348) and mRNA cap (Guanine N-7) methyltransferase (102560) families |
![]() | Protein Hypothetical protein PH0226 [142599] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142600] (1 PDB entry) Uniprot O57965 2-227 |
![]() | Domain d1ve3b_: 1ve3 B: [120011] automated match to d1ve3a1 complexed with sam |
PDB Entry: 1ve3 (more details), 2.1 Å
SCOPe Domain Sequences for d1ve3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ve3b_ c.66.1.43 (B:) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]} gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel nqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvviefk seqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk
Timeline for d1ve3b_: