SCOPe 2.07: Domain d1ve3b_: 1ve3 B:

Lineage for d1ve3b_ (1ve3 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.43: CAC2371-like [117688] (3 proteins)
   similar overall fold to the Glycine N-methyltransferase (53348) and mRNA cap (Guanine N-7) methyltransferase (102560) families

6. Protein Hypothetical protein PH0226 [142599] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142600] (1 PDB entry)
   Uniprot O57965 2-227

8. Domain d1ve3b_: 1ve3 B: [120011]
   automated match to d1ve3a1
   complexed with sam

Details for d1ve3b_

PDB Entry: 1ve3, 2.1 Å

PDB Description: crystal structure of ph0226 protein from pyrococcus horikoshii ot3

PDB Compounds: (B:) hypothetical protein PH0226

SCOPe Domain Sequences for d1ve3b_:

Sequence; same for both SEQRES and ATOM records:

>d1ve3b_ c.66.1.43 (B:) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvviefk
seqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk

Timeline for d1ve3b_:

• d1ve3b_ first appeared in SCOP 1.73, called d1ve3b1
  
• d1ve3b_ appears in SCOPe 2.06
  
• d1ve3b_ appears in the current release, SCOPe 2.08