SCOP 1.75: Domain d1ve3b1: 1ve3 B:2-227

Lineage for d1ve3b1 (1ve3 B:2-227)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.43: CAC2371-like [117688] (3 proteins)
   similar overall fold to the Glycine N-methyltransferase ((53348)) and mRNA cap (Guanine N-7) methyltransferase ((102560)) families
   similar overall fold to the Glycine N-methyltransferase ((53348)) and mRNA cap (Guanine N-7) methyltransferase (102560)) families

6. Protein Hypothetical protein PH0226 [142599] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142600] (1 PDB entry)
   Uniprot O57965 2-227

8. Domain d1ve3b1: 1ve3 B:2-227 [120011]
   automatically matched to 1VE3 A:2-227
   complexed with sam

Details for d1ve3b1

PDB Entry: 1ve3, 2.1 Å

PDB Description: crystal structure of ph0226 protein from pyrococcus horikoshii ot3

PDB Compounds: (B:) hypothetical protein PH0226

SCOP Domain Sequences for d1ve3b1:

Sequence; same for both SEQRES and ATOM records:

>d1ve3b1 c.66.1.43 (B:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvviefk
seqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk

Timeline for d1ve3b1:

• d1ve3b1 first appeared in SCOP 1.73
  
• d1ve3b1 is called d1ve3b_ in SCOPe 2.01
  
• d1ve3b1 appears in the current release, SCOPe 2.08, called d1ve3b_