Lineage for d1ve3a1 (1ve3 A:2-227)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146293Family c.66.1.43: CAC2371-like [117688] (3 proteins)
    similar overall fold to the Glycine N-methyltransferase (53348) and mRNA cap (Guanine N-7) methyltransferase (102560) families
  6. 2146299Protein Hypothetical protein PH0226 [142599] (1 species)
  7. 2146300Species Pyrococcus horikoshii [TaxId:53953] [142600] (1 PDB entry)
    Uniprot O57965 2-227
  8. 2146301Domain d1ve3a1: 1ve3 A:2-227 [120010]
    complexed with sam

Details for d1ve3a1

PDB Entry: 1ve3 (more details), 2.1 Å

PDB Description: crystal structure of ph0226 protein from pyrococcus horikoshii ot3
PDB Compounds: (A:) hypothetical protein PH0226

SCOPe Domain Sequences for d1ve3a1:

Sequence, based on SEQRES records: (download)

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvviefk
seqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk

Sequence, based on observed residues (ATOM records): (download)

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeiskvipdqeertvviefsfrvrfnvwg
ktgvellaklyftkeaeekvgnysyltvynpk

SCOPe Domain Coordinates for d1ve3a1:

Click to download the PDB-style file with coordinates for d1ve3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ve3a1: