SCOPe 2.08: Domain d1ve3a1: 1ve3 A:2-227

Lineage for d1ve3a1 (1ve3 A:2-227)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.43: CAC2371-like [117688] (3 proteins)
   similar overall fold to the Glycine N-methyltransferase (53348) and mRNA cap (Guanine N-7) methyltransferase (102560) families

6. Protein Hypothetical protein PH0226 [142599] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142600] (1 PDB entry)
   Uniprot O57965 2-227

8. Domain d1ve3a1: 1ve3 A:2-227 [120010]
   complexed with sam

Details for d1ve3a1

PDB Entry: 1ve3, 2.1 Å

PDB Description: crystal structure of ph0226 protein from pyrococcus horikoshii ot3

PDB Compounds: (A:) hypothetical protein PH0226

SCOPe Domain Sequences for d1ve3a1:

Sequence, based on SEQRES records:

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeslvvgqkywiskvipdqeertvviefk
seqdsfrvrfnvwgktgvellaklyftkeaeekvgnysyltvynpk

Sequence, based on observed residues (ATOM records):

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Pyrococcus horikoshii [TaxId: 53953]}
gfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygf
evvgvdisedmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplel
nqvfkevrrvlkpsgkfimyftdlrellprlkeiskvipdqeertvviefsfrvrfnvwg
ktgvellaklyftkeaeekvgnysyltvynpk

Timeline for d1ve3a1:

• d1ve3a1 first appeared in SCOP 1.73
  
• d1ve3a1 appears in SCOPe 2.07