Lineage for d1ve2b_ (1ve2 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519171Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2519172Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2519173Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2519384Protein automated matches [190790] (4 species)
    not a true protein
  7. 2519412Species Thermus thermophilus [TaxId:274] [188055] (1 PDB entry)
  8. 2519413Domain d1ve2b_: 1ve2 B: [120009]
    Other proteins in same PDB: d1ve2a1
    automated match to d1ve2a1

Details for d1ve2b_

PDB Entry: 1ve2 (more details), 1.8 Å

PDB Description: Crystal structure of uroporphyrin-III-C-methyltransferase from thermus thermophilus
PDB Compounds: (B:) Uroporphyrin-III C-methyltransferase

SCOPe Domain Sequences for d1ve2b_:

Sequence, based on SEQRES records: (download)

>d1ve2b_ c.90.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
rgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvgkegyggk
tpqeaitarlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavga
lsalglplthrglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppetp
lallarvgwpgeavrlgrvedlpglgeglpspallvvgkvvglygellpk

Sequence, based on observed residues (ATOM records): (download)

>d1ve2b_ c.90.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
rgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvqeaitarl
ialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavgalsalglplth
rglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppetplallarvgwp
geavrlgrvedlpglgeglpspallvvgkvvglygellpk

SCOPe Domain Coordinates for d1ve2b_:

Click to download the PDB-style file with coordinates for d1ve2b_.
(The format of our PDB-style files is described here.)

Timeline for d1ve2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ve2a1