SCOPe 2.08: Domain d1ve2b_: 1ve2 B:

Lineage for d1ve2b_ (1ve2 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein automated matches [190790] (4 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [188055] (1 PDB entry)

8. Domain d1ve2b_: 1ve2 B: [120009]
   Other proteins in same PDB: d1ve2a1
   automated match to d1ve2a1

Details for d1ve2b_

PDB Entry: 1ve2, 1.8 Å

PDB Description: Crystal structure of uroporphyrin-III-C-methyltransferase from thermus thermophilus

PDB Compounds: (B:) Uroporphyrin-III C-methyltransferase

SCOPe Domain Sequences for d1ve2b_:

Sequence, based on SEQRES records:

>d1ve2b_ c.90.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
rgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvgkegyggk
tpqeaitarlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavga
lsalglplthrglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppetp
lallarvgwpgeavrlgrvedlpglgeglpspallvvgkvvglygellpk

Sequence, based on observed residues (ATOM records):

>d1ve2b_ c.90.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
rgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvqeaitarl
ialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavgalsalglplth
rglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppetplallarvgwp
geavrlgrvedlpglgeglpspallvvgkvvglygellpk

Timeline for d1ve2b_:

• d1ve2b_ first appeared in SCOP 1.73, called d1ve2b1
  
• d1ve2b_ appears in SCOPe 2.07