Lineage for d1vdna1 (1vdn A:2-162)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674496Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 674500Species Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId:4932] [101878] (2 PDB entries)
  8. 674501Domain d1vdna1: 1vdn A:2-162 [120006]
    automatically matched to d1ista_
    complexed with ace, mcm

Details for d1vdna1

PDB Entry: 1vdn (more details), 1.6 Å

PDB Description: Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
PDB Compounds: (A:) cyclophilin a

SCOP Domain Sequences for d1vdna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdna1 b.62.1.1 (A:2-162) Cyclophilin (eukaryotic) {Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId: 4932]}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

SCOP Domain Coordinates for d1vdna1:

Click to download the PDB-style file with coordinates for d1vdna1.
(The format of our PDB-style files is described here.)

Timeline for d1vdna1: