![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein automated matches [190077] (22 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186798] (1 PDB entry) |
![]() | Domain d1vdna_: 1vdn A: [120006] automated match to d1ista_ |
PDB Entry: 1vdn (more details), 1.6 Å
SCOPe Domain Sequences for d1vdna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vdna_ b.62.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel
Timeline for d1vdna_: