SCOPe 2.08: Domain d1vdna_: 1vdn A:

Lineage for d1vdna_ (1vdn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (22 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186798] (1 PDB entry)

8. Domain d1vdna_: 1vdn A: [120006]
   automated match to d1ista_

Details for d1vdna_

PDB Entry: 1vdn, 1.6 Å

PDB Description: Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin

PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d1vdna_:

Sequence; same for both SEQRES and ATOM records:

>d1vdna_ b.62.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

Timeline for d1vdna_:

• d1vdna_ first appeared in SCOP 1.73, called d1vdna1
  
• d1vdna_ appears in SCOPe 2.07