Lineage for d1vdmk_ (1vdm K:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128454Protein Pprobable purine phosphoribosyltransferase PH0095 [142560] (1 species)
  7. 2128455Species Pyrococcus horikoshii [TaxId:53953] [142561] (1 PDB entry)
    Uniprot O57827 1-153
  8. 2128466Domain d1vdmk_: 1vdm K: [120004]
    automated match to d1vdma1

Details for d1vdmk_

PDB Entry: 1vdm (more details), 2.5 Å

PDB Description: Crystal structure of purine phosphoribosyltransferase from Pyrococcus horikoshii Ot3
PDB Compounds: (K:) purine phosphoribosyltransferase

SCOPe Domain Sequences for d1vdmk_:

Sequence, based on SEQRES records: (download)

>d1vdmk_ c.61.1.1 (K:) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]}
mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
ykgidergekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiacla
mkpwtsvvpdyyvfrtekwivfpweefpviek

Sequence, based on observed residues (ATOM records): (download)

>d1vdmk_ c.61.1.1 (K:) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]}
mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkf
ykekpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpwts
vvpdyyvfrtekwivfpweefpviek

SCOPe Domain Coordinates for d1vdmk_:

Click to download the PDB-style file with coordinates for d1vdmk_.
(The format of our PDB-style files is described here.)

Timeline for d1vdmk_: