![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
![]() | Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins) Pfam PF03009 |
![]() | Protein automated matches [190795] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [188053] (1 PDB entry) |
![]() | Domain d1vd6a_: 1vd6 A: [119991] automated match to d1v8ea1 complexed with gol |
PDB Entry: 1vd6 (more details), 1.3 Å
SCOPe Domain Sequences for d1vd6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vd6a_ c.1.18.3 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} rplrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfq vdyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvw vssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrg lfvvawtvneegearrllalgldgligdrpevllplgg
Timeline for d1vd6a_: