Lineage for d1vd6a_ (1vd6 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 974570Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 974625Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
    Pfam PF03009
  6. 974643Protein automated matches [190795] (2 species)
    not a true protein
  7. 974650Species Thermus thermophilus [TaxId:300852] [188053] (1 PDB entry)
  8. 974651Domain d1vd6a_: 1vd6 A: [119991]
    automated match to d1v8ea1
    complexed with gol

Details for d1vd6a_

PDB Entry: 1vd6 (more details), 1.3 Å

PDB Description: Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase complexed with Glycerol
PDB Compounds: (A:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d1vd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd6a_ c.1.18.3 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
rplrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfq
vdyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvw
vssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrg
lfvvawtvneegearrllalgldgligdrpevllplgg

SCOPe Domain Coordinates for d1vd6a_:

Click to download the PDB-style file with coordinates for d1vd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1vd6a_: