Lineage for d1vd6a1 (1vd6 A:8-224)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685559Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 685598Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (4 proteins)
    Pfam PF03009
  6. 685616Protein Putative glycerophosphodiester phosphodiesterase TTHB141 [141864] (1 species)
  7. 685617Species Thermus thermophilus [TaxId:274] [141865] (2 PDB entries)
  8. 685618Domain d1vd6a1: 1vd6 A:8-224 [119991]
    automatically matched to 1V8E A:8-224
    complexed with gol

Details for d1vd6a1

PDB Entry: 1vd6 (more details), 1.3 Å

PDB Description: Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase complexed with Glycerol
PDB Compounds: (A:) Glycerophosphoryl diester phosphodiesterase

SCOP Domain Sequences for d1vd6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd6a1 c.1.18.3 (A:8-224) Putative glycerophosphodiester phosphodiesterase TTHB141 {Thermus thermophilus [TaxId: 274]}
plrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfqv
dyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvwv
ssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrgl
fvvawtvneegearrllalgldgligdrpevllplgg

SCOP Domain Coordinates for d1vd6a1:

Click to download the PDB-style file with coordinates for d1vd6a1.
(The format of our PDB-style files is described here.)

Timeline for d1vd6a1: