![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) ![]() automatically mapped to Pfam PF02924 |
![]() | Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (2 proteins) |
![]() | Protein automated matches [254435] (1 species) not a true protein |
![]() | Species Enterobacteria phage [TaxId:10710] [254916] (1 PDB entry) |
![]() | Domain d1vd0a_: 1vd0 A: [119990] automated match to d1c5ea_ |
PDB Entry: 1vd0 (more details)
SCOPe Domain Sequences for d1vd0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vd0a_ b.85.2.1 (A:) automated matches {Enterobacteria phage [TaxId: 10710]} tsketfthyqpqgnsdpahtatapgglsakapamtplmldtssrklvawdgttdgaavgi lavaadqtsttltfyksgtfryedvlwpeaasdetkkrtafagtaisiv
Timeline for d1vd0a_: