SCOPe 2.07: Domain d1vd0a_: 1vd0 A:

Lineage for d1vd0a_ (1vd0 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family)
   automatically mapped to Pfam PF02924

5. Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (2 proteins)

6. Protein automated matches [254435] (1 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:10710] [254916] (1 PDB entry)

8. Domain d1vd0a_: 1vd0 A: [119990]
   automated match to d1c5ea_

Details for d1vd0a_

PDB Entry: 1vd0

PDB Description: capsid stabilizing protein gpd, nmr, 20 structures

PDB Compounds: (A:) Head decoration protein

SCOPe Domain Sequences for d1vd0a_:

Sequence; same for both SEQRES and ATOM records:

>d1vd0a_ b.85.2.1 (A:) automated matches {Enterobacteria phage [TaxId: 10710]}
tsketfthyqpqgnsdpahtatapgglsakapamtplmldtssrklvawdgttdgaavgi
lavaadqtsttltfyksgtfryedvlwpeaasdetkkrtafagtaisiv

Timeline for d1vd0a_:

• d1vd0a_ first appeared in SCOP 1.73, called d1vd0a1
  
• d1vd0a_ appears in SCOPe 2.06
  
• d1vd0a_ appears in the current release, SCOPe 2.08