SCOPe 2.05: Domain d1vcvb_: 1vcv B:

Lineage for d1vcvb_ (1vcv B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (20 species)
   not a true protein

7. Species Pyrobaculum aerophilum [TaxId:13773] [187314] (1 PDB entry)

8. Domain d1vcvb_: 1vcv B: [119989]
   Other proteins in same PDB: d1vcva1
   automated match to d1vcva1
   complexed with zn

Details for d1vcvb_

PDB Entry: 1vcv, 2 Å

PDB Description: Structure of 2-deoxyribose-5-phosphate aldolase from Pyrobaculum aerophilum

PDB Compounds: (B:) Probable deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1vcvb_:

Sequence; same for both SEQRES and ATOM records:

>d1vcvb_ c.1.10.1 (B:) automated matches {Pyrobaculum aerophilum [TaxId: 13773]}
mihlvdyallkpyltvdeavagarkaeelgvaaycvnpiyapvvrpllrkvklcvvadfp
fgalptasrialvsrlaevadeidvvapiglvksrrwaevrrdlisvvgaaggrvvkvit
eepylrdeerytlydiiaeagahfiksstgfaeeayaarqgnpvhstperaaaiaryike
kgyrlgvkmaggirtreqakaivdaigwgedparvrlgtstpeall

Timeline for d1vcvb_:

• d1vcvb_ first appeared in SCOP 1.73, called d1vcvb1
  
• d1vcvb_ appears in SCOPe 2.04
  
• d1vcvb_ appears in SCOPe 2.06
  
• d1vcvb_ appears in the current release, SCOPe 2.08