Lineage for d1vcta2 (1vct A:108-201)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615557Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 2615558Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 2615559Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 2615560Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species)
  7. 2615561Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)
    Uniprot O57975 108-201
  8. 2615562Domain d1vcta2: 1vct A:108-201 [119987]
    Other proteins in same PDB: d1vcta1
    complexed with cl, edo, na

Details for d1vcta2

PDB Entry: 1vct (more details), 1.85 Å

PDB Description: Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d1vcta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcta2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairvig

SCOPe Domain Coordinates for d1vcta2:

Click to download the PDB-style file with coordinates for d1vcta2.
(The format of our PDB-style files is described here.)

Timeline for d1vcta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcta1