SCOP 1.73: Domain d1vcta2: 1vct A:108-201

Lineage for d1vcta2 (1vct A:108-201)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (1 family)

5. Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
   Pfam PF02080

6. Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)

8. Domain d1vcta2: 1vct A:108-201 [119987]
   Other proteins in same PDB: d1vcta1
   complexed with cl, edo, na

Details for d1vcta2

PDB Entry: 1vct, 1.85 Å

PDB Description: Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii

PDB Compounds: (A:) hypothetical protein ph0236

SCOP Domain Sequences for d1vcta2:

Sequence; same for both SEQRES and ATOM records:

>d1vcta2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairvig

Timeline for d1vcta2:

• d1vcta2 is new in SCOP 1.73
  
• d1vcta2 appears in SCOP 1.75
  
• d1vcta2 appears in the current release, SCOPe 2.08