Lineage for d1vcta1 (1vct A:9-107)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985195Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985527Superfamily a.7.12: PhoU-like [109755] (2 families) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 1985528Family a.7.12.1: PhoU-like [109756] (3 protein domains)
    Pfam PF01895
  6. 1985529Protein Hypothetical protein PH0236, N-terminal domain [140350] (1 species)
    form dimers of dimers, similar to PhoU subunits and dimers, respectively
  7. 1985530Species Pyrococcus horikoshii [TaxId:53953] [140351] (4 PDB entries)
    Uniprot O57975 9-107
  8. 1985531Domain d1vcta1: 1vct A:9-107 [119986]
    Other proteins in same PDB: d1vcta2
    complexed with cl, edo, na

Details for d1vcta1

PDB Entry: 1vct (more details), 1.85 Å

PDB Description: Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein ph0236

SCOPe Domain Sequences for d1vcta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla
arnvkeaeqvitilqianaiedisnaagdlakmvlegve

SCOPe Domain Coordinates for d1vcta1:

Click to download the PDB-style file with coordinates for d1vcta1.
(The format of our PDB-style files is described here.)

Timeline for d1vcta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcta2