SCOPe 2.05: Domain d1vchc_: 1vch C:

Lineage for d1vchc_ (1vch C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (9 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [188051] (1 PDB entry)

8. Domain d1vchc_: 1vch C: [119982]
   Other proteins in same PDB: d1vcha1
   automated match to d1vcha1
   complexed with acy, ca, cl

Details for d1vchc_

PDB Entry: 1vch, 1.94 Å

PDB Description: Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus

PDB Compounds: (C:) Phosphoribosyltransferase-related protein

SCOPe Domain Sequences for d1vchc_:

Sequence, based on SEQRES records:

>d1vchc_ c.61.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln
qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

Sequence, based on observed residues (ATOM records):

>d1vchc_ c.61.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
tspiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvl
vsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

Timeline for d1vchc_:

• d1vchc_ first appeared in SCOP 1.73, called d1vchc1
  
• d1vchc_ appears in SCOPe 2.04
  
• d1vchc_ appears in SCOPe 2.06
  
• d1vchc_ appears in the current release, SCOPe 2.08