Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein automated matches [190074] (9 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [188051] (1 PDB entry) |
Domain d1vchc_: 1vch C: [119982] Other proteins in same PDB: d1vcha1 automated match to d1vcha1 complexed with acy, ca, cl |
PDB Entry: 1vch (more details), 1.94 Å
SCOPe Domain Sequences for d1vchc_:
Sequence, based on SEQRES records: (download)
>d1vchc_ c.61.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]} metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
>d1vchc_ c.61.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]} metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte tspiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvl vsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
Timeline for d1vchc_:
View in 3D Domains from other chains: (mouse over for more information) d1vcha1, d1vchb_, d1vchd_, d1vche_ |