SCOPe 2.08: Domain d1vcha1: 1vch A:2-175

Lineage for d1vcha1 (1vch A:2-175)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Putative phosphoribosyltransferase TTHA1613 [142558] (1 species)
   putative APRTase in UniProt

7. Species Thermus thermophilus [TaxId:274] [142559] (1 PDB entry)
   Uniprot Q5SHW7 2-175

8. Domain d1vcha1: 1vch A:2-175 [119980]
   Other proteins in same PDB: d1vchb_, d1vchc_, d1vchd_, d1vche_
   complexed with acy, ca, cl

Details for d1vcha1

PDB Entry: 1vch, 1.94 Å

PDB Description: Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus

PDB Compounds: (A:) Phosphoribosyltransferase-related protein

SCOPe Domain Sequences for d1vcha1:

Sequence, based on SEQRES records:

>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]}
etypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttet
spiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaekllnq
rvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

Sequence, based on observed residues (ATOM records):

>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]}
etypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttet
spiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvlv
sdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

Timeline for d1vcha1:

• d1vcha1 first appeared in SCOP 1.73
  
• d1vcha1 appears in SCOPe 2.07