Lineage for d1vcfb1 (1vcf B:23-332)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681784Protein Isopentenyl-diphosphate delta-isomerase [89454] (2 species)
  7. 681790Species Thermus thermophilus [TaxId:274] [141760] (2 PDB entries)
  8. 681792Domain d1vcfb1: 1vcf B:23-332 [119975]
    automatically matched to 1VCF A:23-332
    complexed with cd, fmn

Details for d1vcfb1

PDB Entry: 1vcf (more details), 2.6 Å

PDB Description: Crystal Structure of IPP isomerase at I422
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOP Domain Sequences for d1vcfb1:

Sequence, based on SEQRES records: (download)

>d1vcfb1 c.1.4.1 (B:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]}
ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtggeengerinlalae
aaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlve
mleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalr
dlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlphlplvas
ggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfaigarnp
keargrverv

Sequence, based on observed residues (ATOM records): (download)

>d1vcfb1 c.1.4.1 (B:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]}
ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtggeengerinlalae
aaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlve
mleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalr
dlplaavdvagaggtswarvelceigiptarailevrevlphlplvasggvytgtdgaka
lalgadllavarpllrpalegaervaawigdyleelrtalfaigarnpkeargrverv

SCOP Domain Coordinates for d1vcfb1:

Click to download the PDB-style file with coordinates for d1vcfb1.
(The format of our PDB-style files is described here.)

Timeline for d1vcfb1: