SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vcfa1 (1vcf A:23-332)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080270Protein Isopentenyl-diphosphate delta-isomerase [89454] (3 species)
  7. 2080281Species Thermus thermophilus [TaxId:274] [141760] (1 PDB entry)
    Uniprot Q53W52 23-332
  8. 2080282Domain d1vcfa1: 1vcf A:23-332 [119974]
    complexed with cd, fmn

Details for d1vcfa1

PDB Entry: 1vcf (more details), 2.6 Å

PDB Description: Crystal Structure of IPP isomerase at I422
PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1vcfa1:

Sequence, based on SEQRES records: (download)

>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]}
ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtggeengerinlalae
aaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlve
mleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalr
dlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlphlplvas
ggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfaigarnp
keargrverv

Sequence, based on observed residues (ATOM records): (download)

>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]}
ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtengerinlalaeaae
algvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlvemle
adalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalrdlp
laavdvagaggtswarveewvelceigiptarailevrevlphlplvasggvytgtdgak
alalgadllavarpllrpalegaervaawigdyleelrtalfaigarnpkeargrverv

SCOPe Domain Coordinates for d1vcfa1:

Click to download the PDB-style file with coordinates for d1vcfa1.
(The format of our PDB-style files is described here.)

Timeline for d1vcfa1: