Lineage for d1vcfa1 (1vcf A:23-332)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080270Protein Isopentenyl-diphosphate delta-isomerase [89454] (3 species)
  7. 2080281Species Thermus thermophilus [TaxId:274] [141760] (1 PDB entry)
    Uniprot Q53W52 23-332
  8. 2080282Domain d1vcfa1: 1vcf A:23-332 [119974]
    complexed with cd, fmn

Details for d1vcfa1

PDB Entry: 1vcf (more details), 2.6 Å

PDB Description: Crystal Structure of IPP isomerase at I422
PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1vcfa1:

Sequence, based on SEQRES records: (download)

>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]}
ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtggeengerinlalae
aaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlve
mleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalr
dlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlphlplvas
ggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfaigarnp
keargrverv

Sequence, based on observed residues (ATOM records): (download)

>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]}
ktttglegfrlryqalaglalsevdlttpflgktlkapfligamtengerinlalaeaae
algvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddllrlvemle
adalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalrdlp
laavdvagaggtswarveewvelceigiptarailevrevlphlplvasggvytgtdgak
alalgadllavarpllrpalegaervaawigdyleelrtalfaigarnpkeargrverv

SCOPe Domain Coordinates for d1vcfa1:

Click to download the PDB-style file with coordinates for d1vcfa1.
(The format of our PDB-style files is described here.)

Timeline for d1vcfa1: