SCOPe 2.07: Domain d1vceb_: 1vce B:

Lineage for d1vceb_ (1vce B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.0: automated matches [191315] (1 protein)
   not a true family

6. Protein automated matches [190076] (5 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [186797] (2 PDB entries)

8. Domain d1vceb_: 1vce B: [119973]
   Other proteins in same PDB: d1vcea1
   automated match to d1vhva_
   complexed with sah

Details for d1vceb_

PDB Entry: 1vce, 2.1 Å

PDB Description: Crystal structure of project ID PH0725 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) diphthine synthase

SCOPe Domain Sequences for d1vceb_:

Sequence; same for both SEQRES and ATOM records:

>d1vceb_ c.90.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

Timeline for d1vceb_:

• d1vceb_ first appeared in SCOP 1.73, called d1vceb1
  
• d1vceb_ appears in SCOPe 2.06
  
• d1vceb_ appears in the current release, SCOPe 2.08