Lineage for d1vcea1 (1vce A:1-265)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160460Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2160461Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2160462Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2160467Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 2160473Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries)
    Uniprot O58456 1-265
  8. 2160556Domain d1vcea1: 1vce A:1-265 [119972]
    Other proteins in same PDB: d1vceb_
    complexed with sah

Details for d1vcea1

PDB Entry: 1vce (more details), 2.1 Å

PDB Description: Crystal structure of project ID PH0725 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) diphthine synthase

SCOPe Domain Sequences for d1vcea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcea1 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d1vcea1:

Click to download the PDB-style file with coordinates for d1vcea1.
(The format of our PDB-style files is described here.)

Timeline for d1vcea1: