![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins) Pfam PF00590 |
![]() | Protein Diphthine synthase, DphB [102684] (3 species) diphthamide biosynthesis methyltransferase |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142779] (3 PDB entries) |
![]() | Domain d1vcea1: 1vce A:1-265 [119972] complexed with sah |
PDB Entry: 1vce (more details), 2.1 Å
SCOP Domain Sequences for d1vcea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcea1 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]} mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg klhiveaeylveiagapreilrvnv
Timeline for d1vcea1: