SCOP 1.73: Domain d1vcea1: 1vce A:1-265

Lineage for d1vcea1 (1vce A:1-265)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins)
   Pfam PF00590

6. Protein Diphthine synthase, DphB [102684] (3 species)
   diphthamide biosynthesis methyltransferase

7. Species Pyrococcus horikoshii [TaxId:53953] [142779] (3 PDB entries)

8. Domain d1vcea1: 1vce A:1-265 [119972]
   complexed with sah

Details for d1vcea1

PDB Entry: 1vce, 2.1 Å

PDB Description: Crystal structure of project ID PH0725 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) diphthine synthase

SCOP Domain Sequences for d1vcea1:

Sequence; same for both SEQRES and ATOM records:

>d1vcea1 c.90.1.1 (A:1-265) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

Timeline for d1vcea1:

• d1vcea1 is new in SCOP 1.73
  
• d1vcea1 appears in SCOP 1.75
  
• d1vcea1 appears in the current release, SCOPe 2.08