SCOPe 2.08: Domain d1vcdb_: 1vcd B:

Lineage for d1vcdb_ (1vcd B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein AP6A hydrolase Ndx1 [143758] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
   Uniprot Q75UV1 1-126

8. Domain d1vcdb_: 1vcd B: [119971]
   automated match to d1vc8a1
   complexed with gol, so4

Details for d1vcdb_

PDB Entry: 1vcd, 1.7 Å

PDB Description: Crystal Structure of a T.thermophilus HB8 Ap6A hydrolase Ndx1

PDB Compounds: (B:) Ndx1

SCOPe Domain Sequences for d1vcdb_:

Sequence; same for both SEQRES and ATOM records:

>d1vcdb_ d.113.1.1 (B:) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

Timeline for d1vcdb_:

• d1vcdb_ first appeared in SCOP 1.73, called d1vcdb1
  
• d1vcdb_ appears in SCOPe 2.07