![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (7 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (16 proteins) |
![]() | Protein AP6A hydrolase Ndx1 [143758] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries) |
![]() | Domain d1vcda1: 1vcd A:1-126 [119970] automatically matched to 1VC8 A:1-126 complexed with gol, so4 |
PDB Entry: 1vcd (more details), 1.7 Å
SCOP Domain Sequences for d1vcda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva lerlpl
Timeline for d1vcda1: