Lineage for d1vcda_ (1vcd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971514Protein AP6A hydrolase Ndx1 [143758] (1 species)
  7. 2971515Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
    Uniprot Q75UV1 1-126
  8. 2971516Domain d1vcda_: 1vcd A: [119970]
    automated match to d1vc8a1
    complexed with gol, so4

Details for d1vcda_

PDB Entry: 1vcd (more details), 1.7 Å

PDB Description: Crystal Structure of a T.thermophilus HB8 Ap6A hydrolase Ndx1
PDB Compounds: (A:) Ndx1

SCOPe Domain Sequences for d1vcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcda_ d.113.1.1 (A:) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

SCOPe Domain Coordinates for d1vcda_:

Click to download the PDB-style file with coordinates for d1vcda_.
(The format of our PDB-style files is described here.)

Timeline for d1vcda_: