Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein AP6A hydrolase Ndx1 [143758] (1 species) |
Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries) Uniprot Q75UV1 1-126 |
Domain d1vcda_: 1vcd A: [119970] automated match to d1vc8a1 complexed with gol, so4 |
PDB Entry: 1vcd (more details), 1.7 Å
SCOPe Domain Sequences for d1vcda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcda_ d.113.1.1 (A:) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva lerlpl
Timeline for d1vcda_: