Lineage for d1vc9b1 (1vc9 B:1-126)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 731931Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 731978Protein AP6A hydrolase Ndx1 [143758] (1 species)
  7. 731979Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
  8. 731985Domain d1vc9b1: 1vc9 B:1-126 [119969]
    automatically matched to 1VC9 A:1-126
    complexed with atp, mg; mutant

Details for d1vc9b1

PDB Entry: 1vc9 (more details), 2.3 Å

PDB Description: crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant- mg2+-atp complex
PDB Compounds: (B:) Ndx1

SCOP Domain Sequences for d1vc9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vc9b1 d.113.1.1 (B:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweqtgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

SCOP Domain Coordinates for d1vc9b1:

Click to download the PDB-style file with coordinates for d1vc9b1.
(The format of our PDB-style files is described here.)

Timeline for d1vc9b1: