SCOPe 2.07: Domain d1vc9a1: 1vc9 A:1-126

Lineage for d1vc9a1 (1vc9 A:1-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein AP6A hydrolase Ndx1 [143758] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
   Uniprot Q75UV1 1-126

8. Domain d1vc9a1: 1vc9 A:1-126 [119968]
   complexed with atp, mg; mutant

Details for d1vc9a1

PDB Entry: 1vc9, 2.3 Å

PDB Description: crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant- mg2+-atp complex

PDB Compounds: (A:) Ndx1

SCOPe Domain Sequences for d1vc9a1:

Sequence; same for both SEQRES and ATOM records:

>d1vc9a1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweqtgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

Timeline for d1vc9a1:

• d1vc9a1 first appeared in SCOP 1.73
  
• d1vc9a1 appears in SCOPe 2.06
  
• d1vc9a1 appears in the current release, SCOPe 2.08