Lineage for d1vc8b_ (1vc8 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535649Protein AP6A hydrolase Ndx1 [143758] (1 species)
  7. 2535650Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
    Uniprot Q75UV1 1-126
  8. 2535654Domain d1vc8b_: 1vc8 B: [119967]
    automated match to d1vc8a1
    complexed with 5fa

Details for d1vc8b_

PDB Entry: 1vc8 (more details), 2 Å

PDB Description: Crystal Structure of a T.thermophilus HB8 Ap6A Hydrolase Ndx1-Ap6A Complex
PDB Compounds: (B:) Ndx1

SCOPe Domain Sequences for d1vc8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vc8b_ d.113.1.1 (B:) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

SCOPe Domain Coordinates for d1vc8b_:

Click to download the PDB-style file with coordinates for d1vc8b_.
(The format of our PDB-style files is described here.)

Timeline for d1vc8b_: