SCOPe 2.08: Domain d1vc8b_: 1vc8 B:

Lineage for d1vc8b_ (1vc8 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein AP6A hydrolase Ndx1 [143758] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
   Uniprot Q75UV1 1-126

8. Domain d1vc8b_: 1vc8 B: [119967]
   automated match to d1vc8a1
   complexed with 5fa

Details for d1vc8b_

PDB Entry: 1vc8, 2 Å

PDB Description: Crystal Structure of a T.thermophilus HB8 Ap6A Hydrolase Ndx1-Ap6A Complex

PDB Compounds: (B:) Ndx1

SCOPe Domain Sequences for d1vc8b_:

Sequence; same for both SEQRES and ATOM records:

>d1vc8b_ d.113.1.1 (B:) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

Timeline for d1vc8b_:

• d1vc8b_ first appeared in SCOP 1.73, called d1vc8b1
  
• d1vc8b_ appears in SCOPe 2.07