SCOP 1.73: Domain d1vc8a1: 1vc8 A:1-126

Lineage for d1vc8a1 (1vc8 A:1-126)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.1: MutT-like [55812] (16 proteins)

6. Protein AP6A hydrolase Ndx1 [143758] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)

8. Domain d1vc8a1: 1vc8 A:1-126 [119966]
   complexed with 5fa

Details for d1vc8a1

PDB Entry: 1vc8, 2 Å

PDB Description: Crystal Structure of a T.thermophilus HB8 Ap6A Hydrolase Ndx1-Ap6A Complex

PDB Compounds: (A:) Ndx1

SCOP Domain Sequences for d1vc8a1:

Sequence; same for both SEQRES and ATOM records:

>d1vc8a1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

Timeline for d1vc8a1:

• d1vc8a1 is new in SCOP 1.73
  
• d1vc8a1 appears in SCOP 1.75
  
• d1vc8a1 appears in the current release, SCOPe 2.08