SCOPe 2.05: Domain d1vbub_: 1vbu B:

Lineage for d1vbub_ (1vbu B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186796] (4 PDB entries)

8. Domain d1vbub_: 1vbu B: [119964]
   automated match to d1xyza_
   complexed with acy, gol, so4

Details for d1vbub_

PDB Entry: 1vbu, 1.8 Å

PDB Description: Crystal structure of native xylanase 10B from Thermotoga maritima

PDB Compounds: (B:) endo-1,4-beta-xylanase B

SCOPe Domain Sequences for d1vbub_:

Sequence; same for both SEQRES and ATOM records:

>d1vbub_ c.1.8.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
denynpkpcyyaikevlekkieer

Timeline for d1vbub_:

• d1vbub_ first appeared in SCOP 1.73, called d1vbub1
  
• d1vbub_ appears in SCOPe 2.04
  
• d1vbub_ appears in SCOPe 2.06
  
• d1vbub_ appears in the current release, SCOPe 2.08