Lineage for d1vbub1 (1vbu B:517-840)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682957Protein Xylanase [51488] (6 species)
  7. 682976Species Thermotoga maritima [TaxId:2336] [141772] (2 PDB entries)
  8. 682978Domain d1vbub1: 1vbu B:517-840 [119964]
    automatically matched to 1VBR A:517-840
    complexed with acy, gol, so4

Details for d1vbub1

PDB Entry: 1vbu (more details), 1.8 Å

PDB Description: Crystal structure of native xylanase 10B from Thermotoga maritima
PDB Compounds: (B:) endo-1,4-beta-xylanase B

SCOP Domain Sequences for d1vbub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbub1 c.1.8.3 (B:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]}
vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
denynpkpcyyaikevlekkieer

SCOP Domain Coordinates for d1vbub1:

Click to download the PDB-style file with coordinates for d1vbub1.
(The format of our PDB-style files is described here.)

Timeline for d1vbub1: