![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (131 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [186796] (4 PDB entries) |
![]() | Domain d1vbub_: 1vbu B: [119964] automated match to d1xyza_ complexed with acy, gol, so4 |
PDB Entry: 1vbu (more details), 1.8 Å
SCOPe Domain Sequences for d1vbub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbub_ c.1.8.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf denynpkpcyyaikevlekkieer
Timeline for d1vbub_: