Lineage for d1vbua_ (1vbu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084247Species Thermotoga maritima [TaxId:2336] [186796] (4 PDB entries)
  8. 2084248Domain d1vbua_: 1vbu A: [119963]
    automated match to d1xyza_
    complexed with acy, gol, so4

Details for d1vbua_

PDB Entry: 1vbu (more details), 1.8 Å

PDB Description: Crystal structure of native xylanase 10B from Thermotoga maritima
PDB Compounds: (A:) endo-1,4-beta-xylanase B

SCOPe Domain Sequences for d1vbua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbua_ c.1.8.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
denynpkpcyyaikevlekkieer

SCOPe Domain Coordinates for d1vbua_:

Click to download the PDB-style file with coordinates for d1vbua_.
(The format of our PDB-style files is described here.)

Timeline for d1vbua_: